SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018156 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018156
Domain Number 1 Region: 5-436
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-124
Family ALDH-like 0.000000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018156   Gene: ENSCPOG00000021502   Transcript: ENSCPOT00000023180
Sequence length 468
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:8154009:8163576:1 gene:ENSCPOG00000021502 transcript:ENSCPOT00000023180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFQDAVRRLREAFSSGRTRPAAFRAAQLEGLSRFLRENKQQLLDALAQDLRKSAFESE
ISEIAISQSEVDLALRNLKAWMKDQKVPKNLATQLDSAFIRKEPFGLVLIVTPWNYPLNL
TLVPLVGAIAAGNCVVLKPSEISKSVEKILAEVLPRYLDQSCFVVALGGPEETKKLLEHR
FDYIFFTGSPHVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRLAWLRYFNT
GQTCVAPDYVLCSPETRERLVPALQNAITRFYGDDPQNSPNLGRIISEKHFKRLKGLLSC
GRVAIGGQSDENNLYIAPTVLVDVQETEPVMQEEIFGPILPLMTVRSLDEAIDFINRREK
PLALYAFSNNSQVVKQVLARTSSGGFCGNDGFMHMTLPSLPFGGVGASGMGSYHGKFSFD
TFSHHRACLLRSPGMEKINDFRYPPYTPRNLRVLLMAMEERSCSCTLL
Download sequence
Identical sequences H0W5A4
XP_003468358.1.53824 XP_005003087.1.53824 XP_013006293.1.53824 ENSCPOP00000018156 ENSCPOP00000018156 10141.ENSCPOP00000018156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]