SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018206 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018206
Domain Number 1 Region: 19-118
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.000000000000017
Family Nucleoplasmin-like core domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018206   Gene: ENSCPOG00000026533   Transcript: ENSCPOT00000026917
Sequence length 184
Comment pep:novel scaffold:cavPor3:scaffold_30:23942314:23942948:1 gene:ENSCPOG00000026533 transcript:ENSCPOT00000026917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSHRSTSSLENKAERTLSRGAELNSERRICTFRPQAEEDSCRLVLSAICLGEKAKEKVYR
VEIVPSARPEDKRPQTITIATLKLSVLPMWPRRFLAFSPGHLPAVGLLGAVFLSGQECHY
GSSDSYEETNVSIEDTPSKLVKRLVPQKQTSMAKEDTARRSVSYKTPSKKGKSSERSRKL
EAKK
Download sequence
Identical sequences ENSCPOP00000018206 10141.ENSCPOP00000018206 ENSCPOP00000018206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]