SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018266 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018266
Domain Number 1 Region: 7-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.49e-51
Family Extradiol dioxygenases 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018266   Gene: ENSCPOG00000019649   Transcript: ENSCPOT00000025679
Sequence length 372
Comment pep:known_by_projection scaffold:cavPor3:scaffold_133:1557448:1558566:-1 gene:ENSCPOG00000019649 transcript:ENSCPOT00000025679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARACGLCHIAFHVPAGQPLARRLQRFFGFQPLAAREAGGWKQLALRSGDAVFLVNEGA
GPGEPLYGVDLHHSVPSATNLCFDVEDPDAAARALAAQGCRVLVPPVRVQDAQGAATYTV
LRSPAGNLSLTLLARASYRGRFLPGFRPVPSAPGPCWVSHVDHLTLACTSGSSPALRRWF
HDYLGFRHLPLSPGEDPELGLEVAAGSGGGGLRLTALQSPMCSSVPTLVLAESLPGATST
QDQVEQFLARHRGPGLQHVGLYTPNILEATKEMVLAGGELLKPPEAYYQQPGKEGQIHAA
GQQPSFLAQQGILIDGEKGKFLLQVFTKSLFAEDTFFLELIQRQGATGFGQDNIRALWQS
VQEAAARKSQGA
Download sequence
Identical sequences H0W5L3
ENSCPOP00000018266 10141.ENSCPOP00000018266 XP_003462548.1.53824 ENSCPOP00000018266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]