SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018446 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018446
Domain Number 1 Region: 6-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.54e-102
Family Carbonic anhydrase 0.0000000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018446   Gene: ENSCPOG00000024957   Transcript: ENSCPOT00000023755
Sequence length 264
Comment pep:known_by_projection scaffold:cavPor3:scaffold_22:9916756:9924379:-1 gene:ENSCPOG00000024957 transcript:ENSCPOT00000023755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGMTGWGYGQEDGPSNWHKLYPIAQGERQSPINIISSQAVYSPSLQPLELSYEVCTSLS
ITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHEVGSEHTVDGKSFTSEL
HLVHWNAKKYSTFGEAASAPDGLAVVGIFLETGDEHPSMNRLTDALYMVRFKGTKAQFSC
FNPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLRDPISISERQMEKFRSLLFTSEDDER
IHMVNNFRPPQPLKGRVVKASFKA
Download sequence
Identical sequences ENSCPOP00000018446 ENSCPOP00000018446 10141.ENSCPOP00000018446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]