SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018617 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018617
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily DNA-binding domain 4.9e-28
Family Methyl-CpG-binding domain, MBD 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018617   Gene: ENSCPOG00000026210   Transcript: ENSCPOT00000025654
Sequence length 290
Comment pep:known_by_projection scaffold:cavPor3:scaffold_320:340461:350316:-1 gene:ENSCPOG00000026210 transcript:ENSCPOT00000025654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDEAPPDKACADEDDEDEEEEEDEEPEPDPELEHV
Download sequence
Identical sequences H0W6L3
ENSCPOP00000018617 10141.ENSCPOP00000018617 XP_003461030.2.53824 XP_004999331.1.53824 ENSCPOP00000018617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]