SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018858 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018858
Domain Number 1 Region: 357-615
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-79
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 209-316
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-34
Family Kringle modules 0.00048
Further Details:      
 
Domain Number 3 Region: 49-103
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-19
Family Fibronectin type II module 0.0043
Further Details:      
 
Domain Number 4 Region: 109-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018858
Domain Number - Region: 189-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00383
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018858   Gene: ENSCPOG00000003752   Transcript: ENSCPOT00000028420
Sequence length 617
Comment pep:known_by_projection scaffold:cavPor3:scaffold_17:23134183:23142021:-1 gene:ENSCPOG00000003752 transcript:ENSCPOT00000028420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGRQLDQQTDAMRVLLLLGSLLVSLESALSAPPPWKAPKERRHRAEEFTVGLTVTGEPC
YFPFQYNRQLYHHCIHKGRPGPRPWCATTPNFDQDQQWAYCLEPKKVKDHCSKHNPCQRG
GICVNTLSSPHCLCPDHLTGKHCQREKCFEPQLHRFFHENEIWFRTGPAGVAKCHCKGPD
AHCKQMHSQECQTNPCLNGGRCLEVEGHHLCDCPMGYTGPFCDLDTTASCYEGRGLSYRG
MARTTVSGAKCQRWASEATYRNMTAEQALRRGLGHHTFCRNPDNDTRPWCFVWMGNRLSW
EYCDLAQCQYPPQPTATPHDRFEHPKLPSSRLSILQTPQPTTQNQALANELPETSSLLCG
QRLRKRLSSLSRIVGGLVALPGAHPYIAALYWGSNFCSGSLIAPCWVLTAAHCLQNRPAP
EELKVVLGQDRHNQSCEHCQTLAVHSYRLHEAFSPSSYLNDLALLRLQKSADGSCAQLSP
YVQTVCLPSGPAPPSESETTCCEVAGWGHQFEGAEEYSSFLQEAQVPLISSERCSSPEVH
GDAFLSGMLCAGFLEGGTDACQGDSGGPLVCEDEAAEHRLILRGIVSWGSGCGDRNKPGV
YTDVASYLTWIQKHTAS
Download sequence
Identical sequences H0W7A4
10141.ENSCPOP00000018858 ENSCPOP00000003389 ENSCPOP00000018858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]