SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019316 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019316
Domain Number 1 Region: 151-275
Classification Level Classification E-value
Superfamily FKBP-like 1.81e-39
Family FKBP immunophilin/proline isomerase 0.00021
Further Details:      
 
Domain Number 2 Region: 276-381
Classification Level Classification E-value
Superfamily FKBP-like 7.66e-36
Family FKBP immunophilin/proline isomerase 0.00036
Further Details:      
 
Domain Number 3 Region: 43-155
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-35
Family FKBP immunophilin/proline isomerase 0.00027
Further Details:      
 
Domain Number 4 Region: 391-488
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-31
Family FKBP immunophilin/proline isomerase 0.00045
Further Details:      
 
Domain Number 5 Region: 495-569
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000318
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019316   Gene: ENSCPOG00000020998   Transcript: ENSCPOT00000020970
Sequence length 583
Comment pep:known_by_projection scaffold:cavPor3:scaffold_53:11919977:11925877:1 gene:ENSCPOG00000020998 transcript:ENSCPOT00000020970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRAGTMFHAGLPGRLPLLQALLALHTMGRTLGRASPAGGPLEDVVIERYHIPRACPREV
QMGDFVRYHYNGTFEDGKKFDSSYDRSSLVAIVVGVGRLITGMDRGLMGMCVNERRRLVV
PPHLGYGSIGVGEMPRPDATLYFDVVLLDVWNQADTVQVSVLLRPPLCLRMVQDGDFVRY
HYNGTLLNGAPFDSSYSRGGTYDTYVGSGWLIKGMDQGLQGMCPGERRRVTIPPFLAYGE
KGYGTVIPPQASLVFQVLLVDVHNPKDTAQVDTLEVPADCERKAASGDFMRYHYNGSLMD
GTPFDSSYSRNQTYDTYIGQGYIIPGMDQGLQGACMGERRRITVPPHLAYGENGTGNKIP
GSAVLVFHVHVIDFHNPTDSVGIETLSRPAEPCNETSKLGDFIRYHYNCSLMDGTRLFSS
HDYGAPQEATLGANKVIEGLDRGLQGMCVGERRRLVVPPHLAHGESGARGVPGSAVLQFE
VELLSREDGLPDGYLFVWHEDPPASLFEDMDLNKDGEVPPEEFSVFIKTQVQEGKGRLLP
GQDPEKTIGDMFRNQDRDQDGSITAAELKLKSEEDEERVHEEL
Download sequence
Identical sequences ENSCPOP00000019316 10141.ENSCPOP00000019316 ENSCPOP00000019316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]