SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019416 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019416
Domain Number 1 Region: 241-566
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 6.77e-62
Family Glutamine synthetase catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 131-237
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.83e-19
Family Glutamine synthetase, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019416   Gene: ENSCPOG00000008736   Transcript: ENSCPOT00000022269
Sequence length 569
Comment pep:known scaffold:cavPor3:scaffold_0:82817486:82848584:1 gene:ENSCPOG00000008736 transcript:ENSCPOT00000022269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDEKGELLQEHAAKDEDNETEASRMSKLRRTRKKVSKTHLCSTQVEEMNASDSNERTGN
QMVCHAPGDMSKPTESHLSHNDKDSQDQTTVIKAPPPKTATSVLVGESNSNSDHAGNSTQ
ILTPPQLSSKMKHIKQEMAKNHLQFVRFEATDLHGVSRSKTIPAYFFQEKVIQGVFMPRG
YLELIPNPKDDEVNHIRATCFNSDIVLMPELSTFRVLPWVERTARVICDTFTVTGEPLLT
SPRYMAKRQLSQLQDAGFSLLSAFLYDFCIFGVPEVINSKTVSFPASTFLFNHDQPFMQE
LVDGLYHTGATVESFSSSTRPGQMEICFLPEFGITSADNAFTLRTGVKEVARKYNYIASF
FVETGFCNSGVLSHSVWDLSGKENLFCSGSGSGQLTVPGRKWLAGLLRHSAALSCLMAPA
VSCRKRYHKDSKDPKPTVPATWGYNDNSCAFNIKSHGGRGTLIENKLGSATANPYLVLAA
TVAAGLDGLQSCEDAELDLGPADSTGVCQPPLAEIPLKLEDALVALEEDQCLRQALGETF
IRYFVAMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences Q2LEC3
ENSCPOP00000007842 NP_001166558.1.53824 ENSCPOP00000019416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]