SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019591 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019591
Domain Number 1 Region: 35-493
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-131
Family ALDH-like 0.0000000000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019591   Gene: ENSCPOG00000003995   Transcript: ENSCPOT00000004039
Sequence length 498
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:18817986:18821380:1 gene:ENSCPOG00000003995 transcript:ENSCPOT00000004039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WESQPCAEPGLELHAEPASVYSSAAALPNSIPNLDVHYSQLFIDNVTVSKKTFPTVNPTT
AEVIGLVANGDQADVDLAVKAAREAFLGSPWCRMDASEGRLLNRLADLVEWDQVYLASLE
TLDNGKPFQEFYALDLDEVIKVYRYFAGWADKWHGKTIPMDEEHFCFTCHEPVGACGQII
PWNFPLVMLAPALDTSSTVVTKVAEQTPLSALYLASLVKEAGFSPGVVNVITGYGPTAGT
AITRHMDVGKVAFTGSTEEGHLIQKVVGDSNLKRVTLKLGGKSPSIVLADANVDHAVDQC
HEAVFFNMGQCCASFIEESIYDEFLKRVVEKAKQRKVGSAFEPDTQQGPQVDKEQFERIL
GCILARRRGYSCFVVGFRKQGFFKLTVFAGMQDDIRIAQEEIFGPVQFKKIEVVIERASS
TRYGLAAAMFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGL
QAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences 10141.ENSCPOP00000019591 ENSCPOP00000019591 ENSCPOP00000019591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]