SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019638 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019638
Domain Number 1 Region: 1-415
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-150
Family ALDH-like 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019638   Gene: ENSCPOG00000027113   Transcript: ENSCPOT00000024422
Sequence length 417
Comment pep:known_by_projection scaffold:cavPor3:scaffold_38:18836738:18855388:1 gene:ENSCPOG00000027113 transcript:ENSCPOT00000024422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERSSLLRKWYDLMMQNKDDLAKIITAESGKPLKEAQGEILYSAHFLEWFSEEARRVYGDI
ISTPTKERRALVLKQPLGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSAL
ALAQLANQAGIPAGVYNVVPCSRAKASEVGEVLCTDPLVSKISFTGSTVTGKVLLRHAAS
TVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCANRFLVQRGIHDSFVK
KFAEAIHNSLHIGNGFEEGTTQGPLINEKAVEKVEKHVSDAVSKGATVVTGGKRHSYGRN
FFEPTLLSNVTVDMLCSHEETFGPLAPVIKFDTEEEAIAIANATDVGLAGYFYSQDPAQI
WRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEIKYVCYGGL
Download sequence
Identical sequences ENSCPOP00000019638 ENSCPOP00000019638 10141.ENSCPOP00000019638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]