SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019848 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019848
Domain Number 1 Region: 51-271
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 7.65e-67
Family DNA/RNA non-specific endonuclease 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019848   Gene: ENSCPOG00000025286   Transcript: ENSCPOT00000023752
Sequence length 286
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:3526703:3529682:-1 gene:ENSCPOG00000025286 transcript:ENSCPOT00000023752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRAAVTLALGAGLGSVAERLLGRLPVLPVAAAAELPAVPGGPASLGPGELAKYGLPG
VAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRQACDFREDDSVHKYHRATNAD
FRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQ
NVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAAGQIELRSYVLPN
APVDEAIPLERFLVPIESIERASGLLFVPNILARAGTVKAITTGGK
Download sequence
Identical sequences 10141.ENSCPOP00000019848 ENSCPOP00000019848 ENSCPOP00000019848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]