SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019911 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019911
Domain Number 1 Region: 132-202
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000000000000011
Family RILP dimerisation region 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019911   Gene: ENSCPOG00000026321   Transcript: ENSCPOT00000025733
Sequence length 209
Comment pep:known_by_projection scaffold:cavPor3:scaffold_115:316393:328644:1 gene:ENSCPOG00000026321 transcript:ENSCPOT00000025733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPRVREEGEEEGEDCEDEAGPEGALGKSALQLTAEDVYDISYVVGRELMALGSDPRVT
QLQFTIVRVLEMLETLVSEGALAAEALRLERDSLQQEGEWGERSGPRGGRRVDLGPDKMV
VDLTDPNRPRFTLQELKEVLQERNALKAQLLLAQEELRGYRSGLIPPRETPDGRQAKETS
VTRARGPEQGKGERTIMKKLFAFRSGKQT
Download sequence
Identical sequences ENSCPOP00000019911 10141.ENSCPOP00000019911 ENSCPOP00000019911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]