SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019923 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019923
Domain Number 1 Region: 198-363,394-455
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-38
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 459-595
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.04e-27
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.58e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019923
Domain Number - Region: 831-868
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0445
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019923   Gene: ENSCPOG00000027074   Transcript: ENSCPOT00000027571
Sequence length 975
Comment pep:known_by_projection scaffold:cavPor3:scaffold_53:12091478:12102937:-1 gene:ENSCPOG00000027074 transcript:ENSCPOT00000027571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCHFLYGPETSKPVLQQLH
KALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDITQSGGPGLGPP
GVHGDNSHENFLGRRGACSKLWSSKRQSRTILHQLTGHFRRQGQGGMKTSNNMFEPKPSV
PEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYVAVTVPYNVCFSGDDDTPTASRHTL
VSDIVVEMLFILDIILNFRTTYVSQSGQVVSAPRSIGLHYLATWFFVDLIAALPFDLLYV
FNVTVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLMLLMSVFALLAHWMACIWYVIG
RQEMEANNPLLWDIGWLQELGRRLDAPYVNGSAGPSRRSAYIAALYFTLSSLTSVGFGNV
SANTDAEKVFSICTMLVGALMHAVVFGNVTAIIQRLYSRRSLYHRRVKDLEDFVRVHRLP
RPLKQRVLEYFQTTWAANCGIDADELLRDFPEELRADIAMHLNREILQLPLFGAASRGCL
RALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDSTVLAILGKGDLIGADIPE
PGLDSGSEDDASCVLKASGEMKALTYCGLQQLSSRGLAELRLYTEYGATFRAGLPRDLTF
NLRQGSHTSGLGRGSRSPRLSQPRSDSLGSFSDKTLPSIAETEASLEPGGGPRPLRPVLL
PNLSPAQPQGSLVSLLGEELPLFSAPASSSSLSASPSPHGPLRGSAAWKPPQLLIPPLGT
CGPPDLSPRVVDGIEDSGSTAEASTFRFSRRPEPPRPRSQTPHTGTGTGWALTTEAEEVQ
EKVCRLNQELSRLNREVSQLSQELRHVMGLLQGHLGPLGPPAPTAWPPDLRHRPQRLPRS
SPCASGAPQSLQDTTLAEVHCPASTGIVETRFTPSTLAPHPSQPDLPRAPPEPEASPPTL
NFTRPGFQSSSDTLH
Download sequence
Identical sequences ENSCPOP00000019923 10141.ENSCPOP00000019923 ENSCPOP00000019923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]