SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020030 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020030
Domain Number 1 Region: 18-279
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-82
Family Carbonic anhydrase 0.0000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020030   Gene: ENSCPOG00000026479   Transcript: ENSCPOT00000020509
Sequence length 306
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:9485628:9492873:-1 gene:ENSCPOG00000026479 transcript:ENSCPOT00000020509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLAVLALALAASGADTESHWCYQIQVQNSQHNCLGPAQWGGECQKSQQSPIDIVTNK
ARLDYNLGDFSFSGYDKKHSRLVQNNGHSVMVSLEPDVTINGGGLATLYQATQLHLHWSE
DLNNGSEHALDGERFAMEMHIVHQKGIEGGAQNAKDQIAVLAFLVEEGSEHNDGFRVLVE
ALDKIPKPGMNVTMEASSLTDLLPQEDKLKHYFRYQGSLTTPTCDETVVWTVFKERIQLH
KDQILAFSQKLYYDEEQKLKMTDNVRPLQQLGDRLVYTSQAPAQLLPVSLPALLLPTLTY
LLANVL
Download sequence
Identical sequences H0WAL8
10141.ENSCPOP00000020030 XP_003469504.1.53824 ENSCPOP00000020030 ENSCPOP00000020030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]