SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020198 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020198
Domain Number 1 Region: 7-359
Classification Level Classification E-value
Superfamily UROD/MetE-like 8.72e-116
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020198   Gene: ENSCPOG00000024542   Transcript: ENSCPOT00000022558
Sequence length 362
Comment pep:known_by_projection scaffold:cavPor3:scaffold_165:1299664:1302277:1 gene:ENSCPOG00000024542 transcript:ENSCPOT00000022558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRPQSFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRKTRAAQDFFSTCRSPEAC
CELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMIPGKGPTFPEPLREERDLERLRDPA
AVASELGYVFQAITLTRQQLAGRVPLIGFAGAPWTLMTYMIEGGSSSTMAQAKRWLYQRP
QASHQLLRILTDALVPYLIGQVVAGAQALQLFESHAGHLGPQLFNMFALPYIRDVAKRVK
AGLQEAGLAPVPMIIFAKDGHFALEELAQSGYEVIGLDWTVAPKKARELVGKTVTLQGNL
DPCALYASEEEISQLVQQMLDDFGPQRYIANLGHGLYPDMDPEHVGAFVNAVHRYSRLLR
KN
Download sequence
Identical sequences ENSCPOP00000020198 10141.ENSCPOP00000020198 ENSCPOP00000020198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]