SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020213 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020213
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.14e-73
Family Calpain large subunit, catalytic domain (domain II) 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020213   Gene: ENSCPOG00000026094   Transcript: ENSCPOT00000021201
Sequence length 277
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:12733942:12741475:-1 gene:ENSCPOG00000026094 transcript:ENSCPOT00000021201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLGDCWFLVALQALTLHEDIMSRVVPRDQSFTEKYAGIFQFWFWHFGKWVLVVTDDHLPV
NDAGQLVFVSSTCKNLFWGALLEKSYAELCGSYEDLQFGQVSEAFVDFTGGVIMTINQSE
APGNLWHILSQATTSRTLIGCQAYSGAREEGEGLENGLVDGRAYTLTGILKVTYKYGPEY
LVKLPWGKMEWKGVWSDSSSTGELLSPKEKILLLQEYNDGEFWMTLRDFKAYFVLLVIGK
LNPGLLGLEVGQKWMYTMREGQKRSTTGGWMESPQGG
Download sequence
Identical sequences ENSCPOP00000020213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]