SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020345 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020345
Domain Number 1 Region: 8-134
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.18e-31
Family PaaI/YdiI-like 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020345   Gene: ENSCPOG00000019753   Transcript: ENSCPOT00000026554
Sequence length 139
Comment pep:known_by_projection scaffold:cavPor3:scaffold_38:18957559:18973731:1 gene:ENSCPOG00000019753 transcript:ENSCPOT00000026554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMSRNVREVMKFMTRAPGFDRVWEKVTLVSAAPEKVICEMKVEEEHANKQGTLHGGFTA
TLIDSISTMALLFTERGVPGVSVDMNITYMSPAKIGEEIVITANILKQGKTLAFASVDVT
NKATGKLIAQGRHTKHLGN
Download sequence
Identical sequences ENSCPOP00000020345 10141.ENSCPOP00000020345 ENSCPOP00000020345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]