SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020353 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020353
Domain Number 1 Region: 35-72
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000000000602
Family Ribosomal protein L36 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020353   Gene: ENSCPOG00000003770   Transcript: ENSCPOT00000003814
Sequence length 72
Comment pep:known_by_projection scaffold:cavPor3:scaffold_150:1150178:1150393:1 gene:ENSCPOG00000003770 transcript:ENSCPOT00000003814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALAGPHGAAVPALAAPCALMTPRSLPPLPPALGFKTKAVLQKRCRDCYMVKRNGRWYVL
CKSNPKHKQRQM
Download sequence
Identical sequences ENSCPOP00000020353 ENSCPOP00000020353 10141.ENSCPOP00000020353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]