SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020445 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020445
Domain Number 1 Region: 465-663
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.2e-69
Family Hemopexin-like domain 0.00000000205
Further Details:      
 
Domain Number 2 Region: 90-219,392-447
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.23e-38
Family Matrix metalloproteases, catalytic domain 0.000000452
Further Details:      
 
Domain Number 3 Region: 338-394
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-21
Family Fibronectin type II module 0.0000694
Further Details:      
 
Domain Number 4 Region: 278-335
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-21
Family Fibronectin type II module 0.000078
Further Details:      
 
Domain Number 5 Region: 222-277
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-20
Family Fibronectin type II module 0.0000577
Further Details:      
 
Domain Number 6 Region: 43-108
Classification Level Classification E-value
Superfamily PGBD-like 6.91e-20
Family MMP N-terminal domain 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020445   Gene: ENSCPOG00000020846   Transcript: ENSCPOT00000026394
Sequence length 663
Comment pep:known_by_projection scaffold:cavPor3:scaffold_5:13320976:13344818:1 gene:ENSCPOG00000020846 transcript:ENSCPOT00000026394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMRMRVAWATLAGPLRALCFLSCLLLRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKDSCNLFVLKDTLKKMQKFFGLPQTGELDQNTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRILGYTPDLDPETVDDAFARAFQVWSQVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLF
NGREYTSCTDAGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADRQPCKFPFRFQG
TSYNSCTTEGRSDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNK
HESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTFTKHFRLSQDDIKGIQELYGTSPDTDIDTGTGPTPTLGPVTPEICKQDIVFDG
ISQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAG
NEYWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKK
MDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDW
LGC
Download sequence
Identical sequences ENSCPOP00000020445 ENSCPOP00000020445 10141.ENSCPOP00000020445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]