SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020496 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020496
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-19
Family Fibronectin type II module 0.0036
Further Details:      
 
Domain Number 2 Region: 200-245
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000263
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 3 Region: 49-93
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000714
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 4 Region: 140-191
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000234
Family Fibronectin type II module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020496   Gene: ENSCPOG00000011947   Transcript: ENSCPOT00000025373
Sequence length 245
Comment pep:known_by_projection scaffold:cavPor3:scaffold_209:554792:567292:1 gene:ENSCPOG00000011947 transcript:ENSCPOT00000025373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQWSSYLLGWMTFLLYFYETSGLCPNTSCVGLSEDTLKRASRKEELNENCVFPFIYKGS
IYFTCTKINSFLPWCSTRAVYDGRWKYCLIEDYPRCVFPFIFRGKTRNSCISDGSLTGKM
WCSVTSSFDEKQQWKYCEMNEYGGNSFSKPCIFPSKYRNSVISECLEDNSNKLWCPTTED
MDKDGKWSFCADTRLSSSGPGFPCHFPFNYKNKNYFNCTNKGSKNNLTWCATSYNYDQDH
TWVYC
Download sequence
Identical sequences ENSCPOP00000020496 10141.ENSCPOP00000020496 ENSCPOP00000010748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]