SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020834 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020834
Domain Number 1 Region: 72-197
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-39
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 2 Region: 193-305
Classification Level Classification E-value
Superfamily FKBP-like 6.09e-37
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 3 Region: 301-405
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-32
Family FKBP immunophilin/proline isomerase 0.00032
Further Details:      
 
Domain Number 4 Region: 1-81
Classification Level Classification E-value
Superfamily FKBP-like 9.23e-25
Family FKBP immunophilin/proline isomerase 0.00077
Further Details:      
 
Domain Number 5 Region: 410-486
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000042
Family Calbindin D9K 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020834   Gene: ENSCPOG00000019418   Transcript: ENSCPOT00000020218
Sequence length 497
Comment pep:known_by_projection scaffold:cavPor3:scaffold_30:22672002:22693438:-1 gene:ENSCPOG00000019418 transcript:ENSCPOT00000020218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVTIPPKLAYGSEGVAGVIPPNSVLH
FDVLLVDIWNPEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTY
DTYVGIGWLIPGMDNGLLGMCVGEKRIITIPPFLAYGEAGDGKDIPGQASLVFDVVLLDL
HNPKDSISIENQVVPESCERRSQSGDFLRYHYNGTLLDGSLFDSSYSRNRTFDTYIGQGY
VIPGMDEGLLGVCVGERRRIVVPPHLGYGEEGRGNIPGSAVLVFDVHVIDFHNPSDSISV
TSHYRPPDCSVLSKKGDFLKYHYNASLLDGTLLDSTLNLGKTYNIVLGFGQVVLGMDMGL
REMCVGEKRTVIIPPHLGYGEAGVAGEVPGSAVLVFDIELLELVAGLPEGYMFVWNGEVS
PNLFEEIDKNGDGDILLEEFSEYIHAQVATGKGKLAPGFDAEMIVKNMFTNQDRNGDGKV
TAEEFKLKDQETKHDEL
Download sequence
Identical sequences ENSCPOP00000020834 10141.ENSCPOP00000020834 ENSCPOP00000020834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]