SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021022 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021022
Domain Number 1 Region: 345-691
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.79e-89
Family YicI catalytic domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 695-778
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.3e-18
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 3 Region: 71-160,213-343
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000016
Family YicI N-terminal domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021022   Gene: ENSCPOG00000023194   Transcript: ENSCPOT00000028442
Sequence length 917
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:27773740:27836065:1 gene:ENSCPOG00000023194 transcript:ENSCPOT00000028442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TETSGKEEISVEDEAVDRNIFRDCSKIAFYRRQKQQPSKNSTYRALLDSVTIGRESTSFQ
IINEATKLPLLAEVYGIEKNILRLKINEETPLKPRYEVSDVLISKLNTVRLISCCKDTGN
LILSDEKGYLKCHITENPFKIDLVSEKEVVMSINSLGQLYFEHLQIPPKNRATKEHEKST
SIDTSQQQEDQEDLGLWEEKFGNFVDVKANGPASIGLDFSLHGFEHVYGIPQHAESHQLK
NTRDGDAYRLYNLDVYGYQIHDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEP
AVEYTLTQMGPAAAKQKVRCQTDVRWISESGIIDVFLLTGPTPSDVFKQYSCLTGTQAMP
PLFSLGYHQCRWNYEDEQDVRAVDTGFDEHDIPYDVIWLDIEHTEGKRYFTWDKKRFPTP
TRMQELLRSKKRKLVVINDPHIKVDPDYSVYIKAKEQGFFVKTHEGGDFEGVCWPGLSSY
LDFTNPKVREWYAGLFAFSAYQGSTDILFIWNDMNEPSVFRGPEQTMQKNAIHHGNWEHR
ELHNIYGLYQQMATAEGLIQRSKGKERPFVLSRSFFAGSQKYGAVWTGDNTAEWSYLEIS
IPMLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLC
EKEHTHLIREAIRERYTLLPYLYSLFYQAHVASDPVMRPLWIEFPSELETFDIEDEYMLV
GSALLVHPVTEPKATTVDIFLPGSNEVWYDSKTFACWEGGRTMKMPVTLATIPVFQRGGS
VVPVKTAVGKSTGWMTDAPYGLRVALSTEGSAVGELYLDDGHSFQYLHQRQFLHRKLSFC
SRVLTNSCADERGHFSSKCVVEQILVLGLRKEPSSVTTHSSDGKVKPVAFAYCARMSTLS
LEKLSLSIDADWEVHIQ
Download sequence
Identical sequences ENSCPOP00000021022 ENSCPOP00000021022 10141.ENSCPOP00000021022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]