SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021086 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021086
Domain Number 1 Region: 142-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000963
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 2 Region: 315-384
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000279
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000563
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021086   Gene: ENSCPOG00000023069   Transcript: ENSCPOT00000027862
Sequence length 579
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:6959762:6972702:1 gene:ENSCPOG00000023069 transcript:ENSCPOT00000027862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPCPGSEVKCGVGRGASVPWDFLPGLMVKAPPGPCLQAQRKEKSRNAARSRRGKENLE
FFELSKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRVLGAPAGLGPQQQ
SPSALVSEIFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFD
YIHPGDHSEVLEQLGLRAPTSWRPLPVTVWGTGSSVSSYDTTSPDASPAEAPPFAQVQER
SFFVRMKSTLTKRGLHVKASGYKCNQGNQTGDFIGCCNLGNWGPHASLCVPPQPGLTIPL
LVESRVPGLGAEARVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHLDLLDKGQVMTGY
YRWLQRTGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSHAEGSQTPLDTFQLPASTICE
DVSSPGSEPTDGGPPAEGKQAAPPDQDDDPQVRAKHIKVEPRSQEARGSKDSGDEEATEQ
PRAMRPGFTSVIRGALRPWGPEPPRDPPLSLPPSLPPALLPAGFLPPVVRDLCAPGAIRY
APAELGLVCPRLPSAFCPTLGLPCSGLGLAGPRAQQKGD
Download sequence
Identical sequences ENSCPOP00000021086 ENSCPOP00000021086 10141.ENSCPOP00000021086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]