SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000189 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000189
Domain Number 1 Region: 2-538
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.06e-80
Family Acetyl-CoA synthetase-like 0.0000446
Further Details:      
 
Domain Number 2 Region: 738-1084
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.16e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0087
Further Details:      
 
Domain Number 3 Region: 549-625
Classification Level Classification E-value
Superfamily ACP-like 0.0000458
Family Acyl-carrier protein (ACP) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000189   Gene: ENSCPOG00000000215   Transcript: ENSCPOT00000000218
Sequence length 1088
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:26766605:26796481:-1 gene:ENSCPOG00000000215 transcript:ENSCPOT00000000218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELIYQAASLYLDKTAVCFDECNSQPPIYYTYMTVIRAASELSHFLQLHCDFQGIRE
IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTHFIKKCDLQYILVEKKLINKFR
SSFETLLNYDMLTVEHNDLVFVRLHWKNIEVNLMTSDGKEKYDKERKSHMRCENSSEEKE
YMDARHKDCLAYVLHTSGTTGTPKIVRVPHACVLPNVQHFRELFDITPEDVLFLASPLTF
DPSVVEIFIALSSGASLLIVPTSVKVCPSKLAPVLFTHHRVTILQATPTLLRRFGSQLIK
STVLSASTSLRVLALGGESFPSLTVLKSWIGKGNKTQIFNIYGITEVSSWATYYRIPEKI
LNSTLKCELPVQLGFPLLDTVVEVRDTDGFTIQEGSGQVFLGGKNRVCFLDGEVTVPLGT
MRATGDFVTLQGGEMFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQEKL
ILFIVSKDDVVKDHIFKELQKHLPNHAIPDELVLIDSLPFTSHGKVDVSELNKTYLAYVN
LAQNKFSGKEDLWEKLQCLWKSILSLPEDLKVPKESLFLNSGGDSLKSVRLLSEIEQLVG
TPVPELLEVVLSSSILEIYNYILQTVFAIEDVTFTKISASKRKLSDTDQEEASGKSLHQK
SPLPFNYKEINAFLALSRGNQVLSVNTTELGHCPLACYPDLISQTNIKYVKNLDPPALIG
KSKGPSCIAKVSAEGSPVTKAEKMELRVRWRSDTGKCVDASPLVVIPAADNSSATVYIGS
HSGRMKAVDLCSGKVKWEQILGDRIESSACVSVCGNFIIVGCYNGLVYVLKSNSGEMYWM
FTTEDTVKSSATMDPTTGLIYIGSHDQHVYALDIYKKKCIWKLKCEGTVFSSPCLSLNPH
SLYCATLGGLLLAVNPTAGSTVWKHSCGKPLFSSPRCCQQYICIGCVDGNLLCFTHSGEQ
VWQFSTRGPIFSSPCASASEQEIFFGSHDCFIYCCNMKGHLQWKFKTTSRVYTTPFAFCN
YSHNSEMLAAASTDGKLWILESESGQLQSVYQLPGEVFSSPVIWESMLIIGCRNNYIYCL
DLLSSNQK
Download sequence
Identical sequences H0UTF6
XP_005004566.1.53824 XP_013009781.1.53824 10141.ENSCPOP00000000189 ENSCPOP00000000189 ENSCPOP00000000189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]