SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001243 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001243
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-29
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily L27 domain 1.29e-19
Family L27 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001243   Gene: ENSCPOG00000001373   Transcript: ENSCPOT00000001392
Sequence length 206
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:18910322:18988662:1 gene:ENSCPOG00000001373 transcript:ENSCPOT00000001392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRAR
ATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHG
GLKRGDQLLSVNGVSVEGEHHERAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTAR
RRQQQQLLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences 10141.ENSCPOP00000001243 ENSCPOP00000001243 ENSCPOP00000001243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]