SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001278 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001278
Domain Number 1 Region: 255-349
Classification Level Classification E-value
Superfamily TAFH domain-like 2.09e-17
Family TAFH domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 653-701
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000241
Family TBP-associated factors, TAFs 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001278   Gene: ENSCPOG00000001414   Transcript: ENSCPOT00000001433
Sequence length 860
Comment pep:known_by_projection scaffold:cavPor3:scaffold_14:36870994:36999805:-1 gene:ENSCPOG00000001414 transcript:ENSCPOT00000001433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTESAGAGAPAVVSTSGTIALAPAVATPVRVESTPLALGAVTKAPVSVCVESTASQ
PLRSPVGTLVTKVAPVSALPKLSGGPRLPAPQIVTVKAPNTATIQLPANLQLPPGTVLIK
SNSGQLMLVSPQQGVTRAETASTVSSRPAVPVNAQTVKICTMTNSSSQLIKKVAVAPGKT
LAQIGTSMASTVPNPSSVQSISVPASVVTVTPVKPVNTVTTLKPSDLGASSVPSNEPGSK
AERSAAAQVNLSPAMLENVKKCKNFELLLLPPFCSPSQSPLECLASEKLACNHEDAKIEA
EEFTKKLYVELKSSPQPHLVPFLKKSVIALRQLLPNAQSFIQQCVQETSSNVILSTCTTT
VTTSPAVTTSVSSAQTEKPTIAPTAAVPAPVSVQALNPLSGPVGAKTGIVTLHSVGPATV
AGGTTAGTVLLQTSKPLVTSVPNAVTTVSLQPEKPVVSGAAVTLALPSVTFGDKSAAALC
LPPVKPIAASAGTKLDKPVIGTPLQIKLTQPGTLLAQPAGMPPTVKVKQLVVQQPSGGIG
KQGTTVSHSSALTIQKPAQKIPVNTVIPTSKFPPVASILKQITLPGNKILSLQASTTQKN
QIKENGTCFRDEDDINDVTSMAGVNLSEENACILQTNSELVGTLIQSCKDEPFLFIGALQ
KRILDIGKKHDITEFNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYILSSD
TKSQLKFLEKLDQLEKQRKDLEEREMLLKAARSRSNKEDPEQLRLKQKAKELQQLELAQI
QHRDANLTALAAIGPRKKRPLESGNEGSKDNLACGTSSLTATKQFLRPRITRICLRDLIF
CMEQEREMKYSRALYRALLK
Download sequence
Identical sequences 10141.ENSCPOP00000001278 ENSCPOP00000001278 ENSCPOP00000001278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]