SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002451 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002451
Domain Number 1 Region: 336-533
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.23e-66
Family Hemopexin-like domain 0.00000911
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-55
Family Matrix metalloproteases, catalytic domain 0.0000000543
Further Details:      
 
Domain Number 3 Region: 30-106
Classification Level Classification E-value
Superfamily PGBD-like 7.22e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002451   Gene: ENSCPOG00000002700   Transcript: ENSCPOT00000002734
Sequence length 607
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:26403392:26646634:1 gene:ENSCPOG00000002700 transcript:ENSCPOT00000002734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWIVCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAEAMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNVRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPVDPRKHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKGNIGKFNNQILKVEPGYPRSILKDFMGCDPTDRVK
EGHIPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences 10141.ENSCPOP00000002451 ENSCPOP00000002451 ENSCPOP00000002451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]