SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002832 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002832
Domain Number 1 Region: 151-269
Classification Level Classification E-value
Superfamily C-type lectin-like 4.12e-39
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 263-366
Classification Level Classification E-value
Superfamily C-type lectin-like 3.09e-29
Family Link domain 0.0037
Further Details:      
 
Domain Number 3 Region: 47-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000584
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002832   Gene: ENSCPOG00000003126   Transcript: ENSCPOT00000003169
Sequence length 596
Comment pep:known_by_projection scaffold:cavPor3:scaffold_72:8456410:8463355:1 gene:ENSCPOG00000003126 transcript:ENSCPOT00000003169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATSVWAMSLLMLLTLLLVAGDQGTLDATVASAKKELHLQKVGSGAVRAALAELVSLPC
LFTLQPRAGVAQDSARVKWTKVRTASGQRQDVPILVAKDNVVRVAKGWQGRVSLPAYPQH
RANATLLLGPLRASDSGLYRCQVVRGIEDEQDLLPLEVTGVVFHYRAARDRYALTFAEAQ
EACRVSSATIAAPRHLQAAFEDGFDNCDAGWLADRTVRYPITQSRPGCYGDRSSLPGVRS
YGRRDPQELYDVYCFARELGGEVFYVGPPRRLTLAGARAQCRRQGAKLASVGQLHLAWHE
GLDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPAPGGRFDAYCFRAH
HPTPQLGDSETPSSGDEAEILSAEGPPGQEQPEVAAPDAQEPLLSSGDEEPLVLAEEQAS
KKTPGATPSRPTEEAWLAPNPSRTALATGTGTSANVYVEVASAGLLPRRRGLNGRHFQQL
EPYAIGPEGTSTLPLPPGPAGNHVEPPSITEPLGSARSGGPWAILTNEVDVLDAGPPGGR
SPPEPWLWPPTEIPPTTSMPSGMPGLRLEDTEAPTAWPVTSDLARAPLESPVSAPS
Download sequence
Identical sequences 10141.ENSCPOP00000002832 ENSCPOP00000002832 ENSCPOP00000002832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]