SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003175 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003175
Domain Number 1 Region: 1278-1445
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.4e-50
Family Crystallins/Ca-binding development proteins 0.00018
Further Details:      
 
Domain Number 2 Region: 1080-1265
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 5.78e-48
Family Crystallins/Ca-binding development proteins 0.0000695
Further Details:      
 
Domain Number 3 Region: 882-1067
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.09e-44
Family Crystallins/Ca-binding development proteins 0.0012
Further Details:      
 
Domain Number 4 Region: 1446-1578
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.96e-19
Family Ricin B-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003175   Gene: ENSCPOG00000003512   Transcript: ENSCPOT00000003556
Sequence length 1583
Comment pep:known_by_projection scaffold:cavPor3:scaffold_63:6358461:6405393:1 gene:ENSCPOG00000003512 transcript:ENSCPOT00000003556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAKDSPPKRAPAQPEPGPNAKGAAADGGEEAARVIPRELTVKSSSLLPEIKAEHKRGPVP
SHPDGRAEGGRSKELGRSAGASEADTLKPRNHFGVGRSTVTTKVTLPAKPKHVELSLKTP
KNPDSFGNEHNPFSQPVHKGNTATKISLFENKRVTSSSPRHTDIRGTRNIPTSNKTFVGR
AKLNLAKKTKEMEQPEKKVVPNSHQNGVLVKGPAAGSEVPLPEEEILLAPGQRRGEPMES
QASGPQPTCDDTKDVQTNAGCPSEPAATAAIPNQDQKLLKDDSEASDSKRLVVENPIDTA
QAVSSDGDTKDLPPKPQPLIESSKEPSPSLPTPIPVDVPKDTCAQAPISPDLKVSGKHNG
CILPVSHHGKKMPLSKVGSGGEANPPPPQESSSEAVGNECPSKVLVQVRSFVLPVESTQD
VSSQIISESSEVREVQLPSCHNNELEVVSVASCTPPQEEVPGSTSTLPKHTRSKEEEIAK
SDSHIMPAESEKALPIQAQSEGSQTPTMAESTPINSPSSRIYSETPQRPDGSVMNGQDTP
ASLLNVSAGSDDSVFDSSSDMEKFTEIIKKMDSAVCVPQKKKRARTANSCAPHFAMPPIH
EDNLEKVFDPSVFTVGLGKKESQLEMSPGLHLMHSLDSKSKMRPKRASTEHSLLFKSLHA
NTNGKGESQVTPEINDKENRDIPNGGVKRSRLEKSALFSSILSSLPQDKIFSPSVTSVKT
MTTSFSTSQNSSPSLTAVGQPTTEGARPSGSDKEQPNLLPHNSLKVFNFNSSTTSHSGLK
SPSHVEKCLQKEETKEDLNSQSNLHLPETKISKLKNSDDMEKTNHIESVLKSNLPNLGNS
ETDFTSLFKSSLYDPGISFSAMSLSDTKTLRGNVQHKLNPRPGKVVIFSEPDVSDKYIEV
FSDIQDCSSWKLSPVVLIKVVRGCWILYEKPNFEGHSIPLEEGELELSGLWSAEDTLERN
EEIESDKPVVIGSMRHVIQQDYRISQIDLFTEPEGLGLQNSYFDDTEEMQGFGVMQKTCS
IRVHWGVWLIYEEPGFQGVPFILEPGEYPDLLFWNTDTAYIGSMRPMKMGGRKVEFPTDP
KVVIYEKPSFEGRCIELEAELCSVGTEGGKTEEATGDAGLPLLSVGSMKVLRGIWVAYEK
PGFTGHQYLLEEGEYKDWKDWGGYSAELQSLRPVLGDFSNAHMIMYSEKNFGSKGSSIDV
LGIVANLNETGYGVKTQSINVLSGVWVAYENPDFTGEQYILDKGFYTSFEDWGGRNCKIS
SVQPICLDSFAGPRRQNQIHLFSEPQFQGHSLSFEETTSHIDDSFSTKSCRVLGGSWVAY
DGENFSGNQYVLEEGHYPCLSAMGCLPGATFRSLRFIDAEFSEPTIILFERENFKGKKIE
LNAETVNLRSLGFNTQIRSVRVIGGIWVSYEYGNYRGRQFLLSPAEIPNWYEFTGCNQIG
SLRPFVQKRIYFRLRNKATGLFMSTNGNLEDLKLLRIQVMEDVGADDQIWIYQEGCIKCR
IAEDCCLTIVGSLVTSGSKLGLSLDQNVDSQFWCMKSDGRIYSKLKPNLVLDIKGGAQYD
QNHIILNTASEEKLTQVWEAMVL
Download sequence
Identical sequences 10141.ENSCPOP00000003175 ENSCPOP00000003175 ENSCPOP00000003175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]