SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003565 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003565
Domain Number 1 Region: 169-220
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000288
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 2 Region: 113-163
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000558
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003565   Gene: ENSCPOG00000003947   Transcript: ENSCPOT00000003991
Sequence length 261
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:22401918:22408603:-1 gene:ENSCPOG00000003947 transcript:ENSCPOT00000003991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWARVTTTRSKRPLPATSWEDMKEGSPQGRSSDLPKRHQSGAGRPPLKNDTPQEYLNE
DVNGFMEYLRQNSQMAPSGEVIATDSPEMREEIAVALKKDSRREGRRLKRQAAKKNAMVC
FHCRKPGHGVADCPAALENQEMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCG
EMGHLSRSCPENPKGLYADGGGCKLCGSVEHLKRDCPEGQHADRAVTVGRWAKGMSADYE
EVMDAPKVQKPKAKTPKVVHF
Download sequence
Identical sequences 10141.ENSCPOP00000003565 ENSCPOP00000003565 ENSCPOP00000003565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]