SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004044 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000004044
Domain Number - Region: 114-136
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0238
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004044   Gene: ENSCPOG00000004484   Transcript: ENSCPOT00000004533
Sequence length 586
Comment pep:known_by_projection scaffold:cavPor3:scaffold_17:7272415:7285014:-1 gene:ENSCPOG00000004484 transcript:ENSCPOT00000004533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAVDTANAAPLSGSKEMNLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDIN
PHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSITTKYRKGAC
ENCGAMTHKKKDCFERPRRVGAKFTGINIAPDEHIQPQLMFDYDGKRDRWNGYNPEEHMK
IVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDE
DKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA
GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDRGSEVHLQADPTKLELLYKSFKVK
KEDFKEQQKESILEKYGGQEHLDTPPVELLLAQTEDYVEYSRHGTVIKGQERAIACSKYE
EDVKINNHTHIWGSYWKDGKWGYRCCHSFFKYSYCTGEAGKETLNSEECITDDINGEESM
KKPQTLMEICKSRRKDFQTCTRSLCLHHRKSSSESDDEEKKHEKLKKALNAEEARLLQVK
EIMQVDERKRPYNSIYEAREPTEEEMEAYRMKRQRPDDPMASFLGQ
Download sequence
Identical sequences ENSCPOP00000004044 10141.ENSCPOP00000004044 ENSCPOP00000004044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]