SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006413 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006413
Domain Number 1 Region: 22-501
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.64e-128
Family Pyridoxal-dependent decarboxylase 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006413   Gene: ENSCPOG00000007114   Transcript: ENSCPOT00000007184
Sequence length 502
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:46638892:46652340:1 gene:ENSCPOG00000007114 transcript:ENSCPOT00000007184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLCSTDFILMADSEPLPSLDGDPKAAEAWLRDVFEIIMDEAIHKGTRTSEKVCEWKEPEE
LKQLLSLELQTHGEAQKQILEHCRAVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESL
NTSQYTYEIAPVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAMNLARYQRYPDC
KQKGLRALPPLAIFASKECHYSVNKGAAFLGFGTDSVRVVESDERGKMIPGDLERQIKLA
EAEGAVPFLVSATSGTTVLGAFDPLNIIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLD
GIQRANSVAWNPHKLLGAGLQCSVLLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTGD
KVVQCGRHVDCLKLWLLWKAQGGQGLERRIDRAFALAQYLVEEIKKRKGFELVIEPEFVN
VCFWFVPPSLRGKQESPDYSQRLSQVAPVLKERMVKKGSMMIGYQPHGTRGNFFRMIVAN
PMLTRADIDFLLDELERLGQDL
Download sequence
Identical sequences ENSCPOP00000006413 ENSCPOP00000006413 10141.ENSCPOP00000006413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]