SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007301 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007301
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-54
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 943-1198
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-39
Family YWTD domain 0.0000886
Further Details:      
 
Domain Number 5 Region: 1329-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1250-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 899-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000565
Family EGF-type module 0.023
Further Details:      
 
Domain Number 10 Region: 294-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1208-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007301   Gene: ENSCPOG00000008119   Transcript: ENSCPOT00000008194
Sequence length 1609
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:8460647:8534669:1 gene:ENSCPOG00000008119 transcript:ENSCPOT00000008194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSCTPSPHPRALCPTCLILMVCFHPSASPLLLFANRRDVRLVDAGGVKLESTIVVSGLED
AAAVDFQFSKGTVYWTDVSEEAIKQTYLNQTGVATQNVIVSGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGS
TRKIIVDSEIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTQCEEDNG
GCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRARLDGSGAQTLVNTEINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKI
ECANLDGRERHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINMDGTKRRTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVIGTNP
CADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNN
NDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWKDLDNPRSLALDPTKGYIYWTEWGGKP
RIVRAFMDGTNCMTLVNKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLVQGHLDFVMDILVFHSSRQDGLN
DCVHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKCAISRMIPDDQ
HSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGSQAFVLTSLGQSPDRQP
HDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDRPRAITVNAERGYLYFTNM
QDRAPKIERASLDGTEREVLFTTGLIRPVALVVDNSLGKLFWVDADLKRIESCDLSGANR
LTLEDASIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTGIHAVEE
VNLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFAC
ATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEVDCQDR
SDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKPPSDETPAHSSA
IGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHG
PFPGISCSKSMMSSVSLMGGRSGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPAT
DPSLYNMDMFYSSNIPATTRPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDL
NSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSCPOP00000007301 10141.ENSCPOP00000007301 ENSCPOP00000007301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]