SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007433 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007433
Domain Number 1 Region: 248-348
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-29
Family Ras-binding domain, RBD 0.00000196
Further Details:      
 
Domain Number 2 Region: 39-140
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 1000-1097
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 408-503
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.86e-21
Family FHA domain 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007433   Gene: ENSCPOG00000008268   Transcript: ENSCPOT00000008343
Sequence length 1825
Comment pep:known_by_projection scaffold:cavPor3:scaffold_60:3500585:3597345:-1 gene:ENSCPOG00000008268 transcript:ENSCPOT00000008343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAYGSRGSRAQGLLEFCRHTNGQIHDLSPVSILCKDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQLNWNK
DDREGRFVLKNENDAVPAKKAQSNGPEKQEKEGVIQNFKRTLFKMCRLARKSKELTCCRM
NSNRKSRQYTILTSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRS
SDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPKDYCIAR
VMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKTKKHS
EGKPLKGKERADGSGYGSVLPPEKLPYLVELSPGRRSHFAYYSYHSYEDGSDSRDKPKLY
RLQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVDGQRISE
TTMLQSGMKVQFGASHVFKFVDPSQDHSLAKRSVDGGLMVKGPRHKPGTVQETTFDLGGD
VHSGTALPTSRSTTRLDSDRVSSASSTAERGMVKPMIRVDQQQDYRRQESRSQDAAGPDL
ILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQHRPDLSPTER
THKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVL
AHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVN
AALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAA
DCHLSRIVQATTLLTMDKYAPEDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLI
ENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPL
CQRGFCRLIPHTRSPGTWTIYFEGADYESHLIRENTELAQPLRKEPEIITVTLKKQNGMG
LSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMT
RTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPRPKSEGFELYNNSAQNG
SPESPQLPWGEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSTYASGTTAKITS
VSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEDKPHMH
TDSNHSSIAIQRVTRSQEELREDTAYQLERHRVEPVMDRKSDSDMWINQSSSVESSTSSQ
EHLNHSSKSVTPASTLTKSGPGRWKTPAVVPPTPVAISQPIRTDLPPPPPPPPVHYASDF
DGIPMDLPLPPPPNNQVGPQSAQVAAAERKKREEHQRWYEKEKARLEEERERKRREQERK
LGQMRTQSLNPAPFSPLAAQQTKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITI
SKEELSSGDSLSPDPWKRDAREKLEKQQQMHIVDMLSKEIHELQNKADRTTEENDRLRKL
MLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMR
KREAEDRARQEEERRRQEDERVKRDAEEKRRQEEGYYSRLEAERRRQHDEVARRLLEPEE
PGLCRPPLPRDYEPPIPSPGSSAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEED
CSLAGKGPHSYSGSAGTVTGPQDTAWDLREKRARSQDTDVPGSSGAPENLTFKERQRLFS
QGQDVSDKVKASRKLTELENELNTK
Download sequence
Identical sequences ENSCPOP00000007433 10141.ENSCPOP00000007433 ENSCPOP00000007433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]