SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008187 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008187
Domain Number 1 Region: 281-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.01e-57
Family Hemopexin-like domain 0.00014
Further Details:      
 
Domain Number 2 Region: 104-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.15e-44
Family Matrix metalloproteases, catalytic domain 0.0000281
Further Details:      
 
Domain Number 3 Region: 24-90
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000173
Family MMP N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008187   Gene: ENSCPOG00000009116   Transcript: ENSCPOT00000009199
Sequence length 520
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:42321129:42326421:1 gene:ENSCPOG00000009116 transcript:ENSCPOT00000009199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRQQLWLGFLLPVTVLCRALGPAEKKAAMDYLLQFGYLQKPLEGPDNIRPKDVTEALRA
FQEAFGLPISGQLDDTTRAYMQLPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSN
LSPHIARAALLQAFKYWSSVAPLTFQEVQTGWADIRLSFHGRESPYCSNTFDGPGRVLAH
ADIPELGSVHFDEDELWTEGTYRGVNLRIIATHELGHALGLGHSRYTQALMAPIYAGYRP
YFRLHPDDVAGIQALYGKKSPQTKEEEKMKVPTVPPVHREPSPMPDPCSGELDAMMLGPR
GKTYAFKGDYVWTVTESGLGPLFLVSDLWEGLPGKLDAAVYSPRTQWIHFFKGDKVWRYI
NFKMSPGFPKKLNKVEPNLDAALYWPVNQKVFLFKGSGYWQWDELAPTDFSRYPKPIKEL
FTGVPNWPSAAMSWQDGRVYFFKDKKYWCLNRQLRVEKGHPKSTAYNWMHCHPHTPSTTS
SAGDTTPSVMDTISNTDTVLDITSADSTLSLLANVTFPEA
Download sequence
Identical sequences A0A286XAE7
ENSCPOP00000008187 ENSCPOP00000008187 10141.ENSCPOP00000008187 XP_003476021.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]