SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010015 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010015
Domain Number 1 Region: 23-258,455-592
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.24e-37
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010015   Gene: ENSCPOG00000011137   Transcript: ENSCPOT00000011241
Sequence length 1004
Comment pep:known_by_projection scaffold:cavPor3:scaffold_23:30705038:30788055:-1 gene:ENSCPOG00000011137 transcript:ENSCPOT00000011241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTSLQAVALWGKKAPPHSISAIMITDDQQTIVTGSQEGQLCLWNLSPELQISAKELLFG
HSAAVTCLAWARDFSKQPYIVSAAENGEMCVWNVTSGQCVRQATLPYGHASICYYHCSAR
MTGSGWLLCCGEYQDVLVIDAETLTVVHTLMSSQSPDWVTCMCIVHSVRVQEDSLLAVTV
TGDLKVWDLSSSINSIQEKRDVYEKESKFLDSMNCQAIRFCMYTERLLLVVFSRCWKVYD
YCDFALLWTEASAGGRLFAGGEVLAAHRVLVWTEDGCSYIYQLLNSGLSKSSSPADRRLL
RETVYPHLLCSASVEGSQSLPFVMGYMNERKEPFYKVLFSGEVSGKITLWHIPDVPVTKF
DGSPREIPITTTCTLQDNFDRHRTMPQGILGQFSGCGEEVAAEAVTASEYIPSLDRLICG
FEDGTIFITQALSAAQAGLLDVGSVPRGSSSHKALKGHQQRVTSLLYPHGLSSKSDQSWL
VSGDQSSCVILWDIFTDEVLHKFFLEAGPVVSLLMSPENPRPREDWTVCCVCSDHSVALL
HLEEKRPLMQARKHLFPVTTVRWHPVENFLIVGCADDSAYIWEIETGTLERHETGDRARA
ILGCGHGAQLLSCVIKITSCRAGHCLLEQPSRDPQPAGPWPVPGSLLESKCQVVGTGSTP
RPFDVLPMRMKWSGVGFHILLFNLENLVELLLPVPPGGADPSGSFHSSELLRRAWSTVGR
KTLTTKWSRAAAPEAQAPPAGASLSQGDTAVTFVEENDGVKWQKKTKSSKKAQAQPSPGV
SPGLTLDTAKLLLSCLLPWGVDKELDHLCIRHLNIAQPQGPVFLGLASHEDRFSLMLPGT
DSCNPGTKTASSRANLFSRRVLDLSHKYTATLSSQLGTSGGPEDGCDCLPQESNVITYLL
SRLFLVNKLVNVPLELACKVDRSFKVESMHKVKSPVNDILNLSSFYGHLRNGKTDSPPPK
ADISLVKLISSWRDQSVQVPEAMQAVLLAEVEQHMKSQRKSPVD
Download sequence
Identical sequences ENSCPOP00000010015 10141.ENSCPOP00000010015 ENSCPOP00000010015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]