SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011424 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011424
Domain Number 1 Region: 103-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.76e-118
Family Pyridoxal-dependent decarboxylase 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011424   Gene: ENSCPOG00000012699   Transcript: ENSCPOT00000012821
Sequence length 559
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:20094257:20117514:1 gene:ENSCPOG00000012699 transcript:ENSCPOT00000012821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAFEPYFEILEAYSTKAKNYVNGYCTKYEPWELIAWSVLWTLLIVWVYGFIFQPESLWSR
FKKKFFKLVRKMPFIGKKIQSKCSEIKEDLRKHLQFLKVGKDYVKALPAQGLSTTAVLER
LKEYSTIDGVWQEGKASGAVYNGEEKLTELLVQAYATFVWSNPLHPDIFPGVRKLEAEIV
RMACSLFNGGPDSCGCMTSGGTESILMACKAYRDLALEKGIKTPEIVAPVSAHAAFDKAA
SYFGMKMVRIPMNKMMEVDVRAMRRAISRNTAMLVCSAPQFAHGVMDPIPEVAKLAIKYK
IPLHIDACLGGFLIVFMEKAGYPLAKPFDFRVEGVTSISADTHKYGYAPKGSSVLLYSDK
KYRKYQFFISTDWPGGIYASPSIAGSRPGGIIAACWATMMHFGENGYVEATKQIIKTARF
LRSELENIKGIFVLGDPQLSVISLGSHDFDIYRLSNLMTAKGWTLNQLQFPPSIHICITL
VHTRKRVAIQFLKDIRESVTQIMKNAKAKVTGMGAIYGMSQAIIDRNLVAEISSVFLDSL
YSTDAITQGNQMNGSPKPR
Download sequence
Identical sequences ENSCPOP00000011424 ENSCPOP00000011424 10141.ENSCPOP00000011424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]