SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012362 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012362
Domain Number 1 Region: 110-584
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.27e-138
Family Pyridoxal-dependent decarboxylase 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012362   Gene: ENSCPOG00000013724   Transcript: ENSCPOT00000013864
Sequence length 585
Comment pep:known_by_projection scaffold:cavPor3:scaffold_109:606105:684145:-1 gene:ENSCPOG00000013724 transcript:ENSCPOT00000013864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPGSGFWSFGSEDGSADPENPSTARVWCQVAQKFTGGIGNKLSALLYGDADKPADSGE
SVAPRGSARKVACTCNQKPCSCRSAKVNYAFLHSTDLLPACDGERPTLAFLQDVMDILLQ
YVVKTFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILKHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLLARYKMFPEVKEKGMAAVPRLVAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGVMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTIGFEAHIDKCLELAEY
LYNIIKNREGYEMVIDGKPQHTNVCFWYVPPSLRALEDNEERMSRLSKVAPVIKARMMEH
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
Download sequence
Identical sequences H0VPE1
ENSCPOP00000012362 10141.ENSCPOP00000012362 XP_003463212.1.53824 ENSCPOP00000012362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]