SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012907 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012907
Domain Number 1 Region: 308-505
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.45e-69
Family Hemopexin-like domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 85-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.01e-52
Family Matrix metalloproteases, catalytic domain 0.000000513
Further Details:      
 
Domain Number 3 Region: 2-65
Classification Level Classification E-value
Superfamily PGBD-like 1.33e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012907   Gene: ENSCPOG00000014329   Transcript: ENSCPOT00000014471
Sequence length 577
Comment pep:known_by_projection scaffold:cavPor3:scaffold_22:24140324:24147189:-1 gene:ENSCPOG00000014329 transcript:ENSCPOT00000014471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQNWLRLYGYLPQPNRHMSTLRSAQILASALAEMQRFYGIPVTGVLDEETKAWMKRPRC
GVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVW
EQATPLVFQEVPYDDIRLRRQKEADIMVLFASGFHGDSSPFDGMGGFLAHAYFPGPGLGG
DTHFDADEPWTFSSTDLHGNSLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDIDNFQL
PEDDLRGIQQLYGTPDGQPQPTRPLPTMTPQRPGRPDHRPPRPPPPGGKPERPPKPGPPA
QPRTTERPDQYGPNICDGNFDTVAVLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRG
LPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEP
TGHTFFFQEDRYWRFNEETQHGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKY
WKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPDGGAEPGLDGDSTEP
LLLLLCVLGVAYALVQMQRKGAPRMLLYCKRSLQEWV
Download sequence
Identical sequences ENSCPOP00000012907 ENSCPOP00000012907 10141.ENSCPOP00000012907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]