SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017556 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017556
Domain Number 1 Region: 67-198
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-29
Family C-type lectin domain 0.00000344
Further Details:      
 
Domain Number 2 Region: 46-73
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000981
Family Triple coiled coil domain of C-type lectins 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017556   Gene: ENSCPOG00000022089   Transcript: ENSCPOT00000021379
Sequence length 201
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:46317624:46321191:1 gene:ENSCPOG00000022089 transcript:ENSCPOT00000021379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRGPQLLLCALLLTQVAAETPTSKPKKAANARKDLVSPKMFEELKSRLDTLAQEVAVL
KEQQALQTVCLKGAKVHLKCFLAVAQARAFHAAGEDCIARGGTLAAPRSEEENEALREYA
ARSLGAAAELWLGLHDLGSEGSWVDASGAPATFVHWETEITAQPDGGTAENCAAMAGAEH
GRWFDRRCRDELPYVCQFAIV
Download sequence
Identical sequences H0W3K9
ENSCPOP00000017556 ENSCPOP00000017556 10141.ENSCPOP00000017556 XP_003477066.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]