SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017571 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000017571
Domain Number - Region: 42-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00628
Family Sfri0576-like 0.059
Further Details:      
 
Domain Number - Region: 133-299
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0467
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017571   Gene: ENSCPOG00000006967   Transcript: ENSCPOT00000021470
Sequence length 373
Comment pep:novel scaffold:cavPor3:scaffold_7:19451162:19481518:-1 gene:ENSCPOG00000006967 transcript:ENSCPOT00000021470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKRRPVGLGLQQESLWLFCCMCSKISGASELCNQLTSCKNHILEFKENILHLKSTNKHNH
EELLKTLTEMTHEIMQRGNQSENLDEKETDTPSKEETISNLFEDFKFFLPHLRKVKRIYP
EVLIGQGKTGVSFAVGIPTTSRGNHTYLKQTLNSVVSRMTPWEEKDAVVIVSVADSNEDY
VKSVVDMVRKRFKRQVKSGTLEVISVPDFFYPSVIHEEAINYSQKGWRIKQVLDFSVLMA
YAQPKATYYLQLEDDIIAKKMYFTKLTEFIKNMTSNDWFCVQFSVLGFIGKLFKSKDLPE
FVHFFLMFYEERPIDLLVDEIFHIKICDAGEPLEQCLKRKTQVRINYRPSLFQHVGIHSS
LPQREQFLKVRFL
Download sequence
Identical sequences ENSCPOP00000017571 10141.ENSCPOP00000017571 ENSCPOP00000015068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]