SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017638 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017638
Domain Number 1 Region: 120-234
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-26
Family C-type lectin domain 0.00000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017638   Gene: ENSCPOG00000000481   Transcript: ENSCPOT00000020588
Sequence length 235
Comment pep:known scaffold:cavPor3:scaffold_86:3056178:3058057:1 gene:ENSCPOG00000000481 transcript:ENSCPOT00000020588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLLALLLGAVSTRHLKVDTSSLQSLRGEESLAQDGETAEGATREATAGALMPLPEE
EEMEGASGSEDDPEEEEEEEEEEEVEFSSELDVSPEDIQCPKEEDTVKFFSRPGYKTRGY
VMVGSARTFNEAQWVCQRCYRGNLASIHSFAFNYQVQCTSAGLNVAQVWIGGQLRGKGRC
RRFVWVDRTVWNFAYWARGQPWGGRQRGRCVTLCARGGHWRRSHCGKRRPFVCTY
Download sequence
Identical sequences H0W3U0
10141.ENSCPOP00000017638 ENSCPOP00000000424 ENSCPOP00000017638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]