SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019120 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019120
Domain Number 1 Region: 282-476
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-64
Family Hemopexin-like domain 0.0000048
Further Details:      
 
Domain Number 2 Region: 73-244
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.55e-43
Family Matrix metalloproteases, catalytic domain 0.000057
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily PGBD-like 1.88e-16
Family MMP N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019120   Gene: ENSCPOG00000019867   Transcript: ENSCPOT00000022866
Sequence length 531
Comment pep:known_by_projection scaffold:cavPor3:scaffold_237:473336:479242:1 gene:ENSCPOG00000019867 transcript:ENSCPOT00000022866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWLSRFGYLPPADPETGQLQTQEELSKAISAMQQFGGLEATGVLDPATLALMRTPRCSLP
DLPPAAPMRRRRQAPARTKWNRRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDIAPL
DFHEVAGSTADIQIDFSRADHNDRYPFDGPGGTVAHAFFPGDHHAAGDAHFDDDEAWTFR
SSDTQGMDLFAVAVHEFGHAIGLGHVAATSSIMQPYYQGPVGDPLRYGLPYEDRVRVWQL
YGVRESVSPTAQPDAPEPEEPPLLPEPPDNRSSTPPQKDVPHRCSAHFDAVAQIRGEAFF
FKGRYFWRLTRDRHLVSLQPAQMHRFWRGLPRHLDGVDAVYERTSDHKIVFFRGDRYWVF
KDNNVEEGYPRPISDFSLPPGGVDAAFAWAHNDRTYFFKDQLYWRYDDRARRMDPGFPAQ
GPLWRGVPSRLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGEPQA
GTSVEGLPAGPQGRSGVQDGLAVCSCSGAGRTLPLLLPPLLPSALGALARA
Download sequence
Identical sequences ENSCPOP00000019120 10141.ENSCPOP00000019120 ENSCPOP00000019120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]