SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020405 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020405
Domain Number 1 Region: 40-175
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-39
Family C-type lectin domain 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020405   Gene: ENSCPOG00000020711   Transcript: ENSCPOT00000022899
Sequence length 177
Comment pep:novel scaffold:cavPor3:scaffold_37:10623115:10625230:-1 gene:ENSCPOG00000020711 transcript:ENSCPOT00000022899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGIVLPSMALSMSWVLLSCLMLLCQVRGEVSQEELPSPRISCPKGSKAYGSHCYAVYRTP
KSWIDADLACQKRPSGHLVSVLSEAEASFVSALVRSSGSSSPYIWIGLHDPTLGLEPNAG
GWEWSSTDVLDFFNWDRNPSTASDRGFCGSLSQTSGFLKWRDYSCNAQLPYVCKFRD
Download sequence
Identical sequences ENSCPOP00000020405 ENSCPOP00000020405 10141.ENSCPOP00000020405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]