SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519603|ref|NP_922980.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519603|ref|NP_922980.1|
Domain Number 1 Region: 221-346,408-479
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.71e-38
Family Intein (protein splicing domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 480-696
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.69e-37
Family RecA protein-like (ATPase-domain) 0.0053
Further Details:      
 
Domain Number 3 Region: 13-124
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 3.27e-32
Family N-terminal domain of DnaB helicase 0.0003
Further Details:      
 
Domain Number 4 Region: 169-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000841
Family RecA protein-like (ATPase-domain) 0.092
Further Details:      
 
Weak hits

Sequence:  gi|37519603|ref|NP_922980.1|
Domain Number - Region: 347-411
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00119
Family Intein endonuclease 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519603|ref|NP_922980.1|
Sequence length 709
Comment replicative DNA helicase [Gloeobacter violaceus PCC 7421]
Sequence
MTSSELDLRIEERLPPQNIDAEETILGGLMMDPEALTRVVEHLRPEAFYVESHQIIYRAA
LALHAQGRPTDLLTLSAWLEDNKLTEKIGGRTYLRRLTDAAINTINIDGYGRLVSDKYAL
RMLIRAGQEIAALGFDSATEIPKLLDRAEQTLFAVTQERVQRSLVPASEVLMNIFEQLET
RYQDGSNVFGIPTHFYDLDNYTQGLQPSDLIIVAGRPGMGKCCAADTPIADPVTGALVTI
EEIYRRGEAGKLVEVLTLLGDGRLARVEPSHFVDDGIKPVYRVRTGLGREVKTTLTHPYL
TPTGWKPLAEIAAGARIAVPCRIPVFGSESLPPKEISLLCSRATRDNRIPDPVFRLPRAQ
LVAFLKQLCITADSARVSDRTVEFTSPSKSFCHQLQHLLLRLGVLSALREVSGIFYLDIK
PAAETPIKPASLWSQDLAHHCDLHWDEIASIEYVGNEQVYDLTVPVTHNFVAADICLHNT
AFSLSIAQRIAQKAGLPAVVFSLEMSKEQLVQRLLCSEAGVESHRLRAARISENEWQRIG
QAIGELASIPLYIDDSPNATVTEIRSKARRLQAEQGGRLGLVMIDYLQLMEGAGSDNRVQ
ELSKITRGLKGLARELRVPVMALSQLSRSVEARTNKRPMLSDLRESGSIEQDADIVLMLY
RDDYYNPDSPDRNIAEVNIVKHRNGPTGTVKLLFENQFTRFLNLTSGNH
Download sequence
Identical sequences Q7NPM1
gi|37519603|ref|NP_922980.1| NP_922980.1.44878 251221.gll0034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]