SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519612|ref|NP_922989.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519612|ref|NP_922989.1|
Domain Number 1 Region: 3-428
Classification Level Classification E-value
Superfamily L-aspartase-like 8.95e-134
Family L-aspartase/fumarase 0.00000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37519612|ref|NP_922989.1|
Sequence length 431
Comment adenylosuccinate lyase [Gloeobacter violaceus PCC 7421]
Sequence
MIERYTLPEMGALWTEEQKYRNWLKVELAACEAMVELGEIPQGAWQEIRTKAGFDVGRIA
ELEAEVRHDVIAFLTSVNEHVGPAGRFIHLGLTSSDVLDTALALQLVQTLDVLALRLEEL
IAATRAKAREHRDTVMIGRTHGIHAEPITFGFKLAGWLAELARHAERLRALRPRLAAGKL
SGAVGTYANLDPRVEARACELLGLVPDTASTQVISRDRHAEFVQALALTAGSIERFAVEI
RNLQRTDVLEVEEYFAAGQKGSSAMPHKRNPIASEQLTGLARIVRSNATAALENMALWHE
RDISHSSVERVILPDSAILVHYMLVKFTALVEKLAVYPENMARNLHRYGGVVFSQRVLLA
LVAKGLTREEAYRIVQTNAHKAWNREGGDFRALIEADPEVQILLAPAELAACFEPRHHLK
HLDTIFARLEI
Download sequence
Identical sequences Q7NPL2
gi|37519612|ref|NP_922989.1| NP_922989.1.44878 251221.gvip003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]