SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519677|ref|NP_923054.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519677|ref|NP_923054.1|
Domain Number 1 Region: 15-242
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 3.92e-89
Family Undecaprenyl diphosphate synthase 0.000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37519677|ref|NP_923054.1|
Sequence length 249
Comment undecaprenyl pyrophosphate synthetase [Gloeobacter violaceus PCC 7421]
Sequence
MTTPHTLLRSLPSDLDPNRLPRHVAAIMDGNGRWASKRNLPRVMGHQAGVSALKELLRCC
KDWGIGALTVYAFSTENWKRPQYEVEFLMALFEKVLNHELSEMVDEGVRIRFVGALAHLP
GALQSAIEGAMAATEANTAVEFTVATNYGGRQEIVNACRELAEQVRSGRLLPEQIDEKLF
AQHLYTRELSDPDLLIRTSGEQRLSNYLLWQMAYTEIYVADVLWPDFDRAAFHAALQSYQ
GRQRRFGKV
Download sequence
Identical sequences Q7NPE7
NP_923054.1.44878 gi|37519677|ref|NP_923054.1| 251221.gll0108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]