SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519833|ref|NP_923210.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519833|ref|NP_923210.1|
Domain Number 1 Region: 291-491
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.75e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 779-1004
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000993
Further Details:      
 
Domain Number 3 Region: 42-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.49e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0032
Further Details:      
 
Domain Number 4 Region: 139-183,269-321
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.12e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0076
Further Details:      
 
Domain Number 5 Region: 548-639
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000000000398
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.011
Further Details:      
 
Domain Number 6 Region: 692-781
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000549
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0044
Further Details:      
 
Domain Number 7 Region: 184-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519833|ref|NP_923210.1|
Sequence length 1028
Comment AcrB/AcrD/AcrF family protein [Gloeobacter violaceus PCC 7421]
Sequence
MRWNISAWSIRNPVPTVVLFLMLTVAGVAAFLNLSIAAEPDIDVPAVSVTVTQLGAAPSE
LETQVTRKIEDAVVGLGNVKRLTSTVNDGSSVTRVEFFLGTNTDRAVNDVRDAVTKIRAQ
LPQSIDPPVVRRNDEAGGPILGYTVYSKQRTNAEISWLVDNTITRAVLTVPGVSRVYRSG
GVTREVRIELNPNRLQALGVTADQLNGQIRALNIDLPGGRGEVGPGEQAIRTLGSAATVE
RLAATQILLSDGRYARLDTLGRVLDGTTEPRQIAYLDGKPGVAFEVVRSKGSNLVNVEEG
VEKKVAELKKILPADIRIDPTWTVGDFVRESYEASVDALLLGAALAVVVIWVFLRDWRST
LIAGLAMPLSAIPTFAVMKTLGFTLNSMTLLALALVIGILVDDAIVEIENIVRHIGMGKS
PFQAALDAADEIGLAVVATTMTIVAVFVPVAFMGGIQGQYYRQFGITVAAAVLFSLVVAR
MLTPLLAAYLMQPLPEAEGKGALARLYDRFLGWAIDHRWVTLAVAGVFFAGSLTLFQTIP
TSLIGAVDDNQSTLAVELPPGATFAQTRLAVERVNAIVMGREEVSKLETTVGTYDNSGKI
NEAKFYISLKPKSERKNSKQKFEAAVREELIAIPGVRFAFSGGNWDSIKTLQIVLKSDDS
VALRRTAAALTDQMRSLPGLTDVSSSAAILRPEIQVRPKFDRAAELGVSVQAIARTALIA
TLGDREADLAKFNLPGRQINIRVQLDAAFRGNLEAIRDLRVASATGELVPLKAVAEVNLG
SGSAQIDRYDRARQVTVGANLLPGTELGPALSQVHQLPALRNLPAGVSEQLTGDAENQRD
VFEGFGFAIGAAVLLIYAVLVLLFGGFLHPLTIMVSLPLSLGGVVLGLLLFGKSLGLYAL
IGIIMLMGLVTKNAILLVEYGLMAIEAGQPRRTALLQAGESRMRPILMTTIAMIAGMLPI
ALGLGAGSEVRSPMAVAVVGGLVTSTLLTLIVVPVVFTCIDDVQQWLLRLAGGTPKASPA
AAAPAQQQ
Download sequence
Identical sequences Q7NNZ4
251221.glr0264 NP_923210.1.44878 gi|37519833|ref|NP_923210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]