SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519844|ref|NP_923221.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519844|ref|NP_923221.1|
Domain Number 1 Region: 77-188,225-426
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 2.07e-41
Family Nitrous oxide reductase, N-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|37519844|ref|NP_923221.1|
Domain Number - Region: 666-880
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.000281
Family Arylsulfatase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37519844|ref|NP_923221.1|
Sequence length 1006
Comment hypothetical protein glr0275 [Gloeobacter violaceus PCC 7421]
Sequence
MTSTRSRLLLSAMLATSLTLQPLAAIAQTSLPVGDIGGNASIIPTGQVVTPTAAPGSTYA
RLSTGLRPDGNADAQGAVKTALSPDGKTLLVLTSGYNQYFADPTTGEFFSYPVLDPITGL
ASTVTNPQAEWVFVFDVSSGALVKKQQINIPNTYNGLVWAPDGKRFYVSAGIDDRIYVYK
FDSGRYVPDAPFILLGHNSNQTDPFPAYDGGILKGTPADAASGGLITTGAVAAGLDISRD
GKTLVVANFQNDSISIIDTASRTVIEEIKFFVPGGTVATGELPFDVAIYSDARGAAAKVF
VTSQRDDEVLAVDLASKVVTRIPVGGQPNKLVLSANQGRLYVANGNSDSLTVIDPVTNNV
VRAISLSRPGYKYKGSNPNAIAFSPDGKKLYVTLGGENAVAVVDQASGKVEGRIPTGWYP
NSVSVIGSKLFVVNAKSNVGPNPSNGRTTAAGEATNTTFKEEYNWALEKAGISTIPVPGG
ASLARLSARVDKNNGFGNQQPDALMAYLRTKIKHVIYVVKENRTYDQVLGDLPVGNGDPS
LTLFPEPISPNHHKLATDFVILDNFYNPGESSGVGWSWSTYARTTDYTEKTQSVLYGNAN
FRGLTYDYEGTNRNISVGLPQTSPTPNQINTRVTGVLDPSGSSSILPGTKDANAPEGDGD
LEPGAIGGYLWDAALRAGKTVRNYGFFIDLAYYGTSLADPTVPDPANPLYIPITRTPFAS
GIPQAPGTKPALLDKTDIYFRGYDQKISDIFLYEEWKREFDGYVANNNLPNLQLVRIMHD
HFGSFDQQAVAGLDTAETQMADNDYALGKLVEAVSKSIYWKDTAIVVLEDDSQDGPDHVD
GHRSIAYVISPYTKRGALVSTNYTTVSALRTIEDLLGLDYLGMLDANTRPMADVFTRVPN
FNTYTAVIPGILCAPPVDPTLVPECADAAALKTVAVKPLHDGQWWAKASKGFNFSVEDKL
DVVAFNRLLWQGIKGTGVSYPEERNRKDLRNNRTQLLNNWTAKQPK
Download sequence
Identical sequences Q7NNY3
251221.glr0275 NP_923221.1.44878 gi|37519844|ref|NP_923221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]