SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519866|ref|NP_923243.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519866|ref|NP_923243.1|
Domain Number 1 Region: 95-297
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.27e-52
Family ATP-binding domain of peptide synthetases 0.00013
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.44e-27
Family D-Alanine ligase N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37519866|ref|NP_923243.1|
Sequence length 302
Comment D-alanine--D-alanine ligase [Gloeobacter violaceus PCC 7421]
Sequence
MRITVLSGSDSPEREVSLVSGRAVQAALETLGHEVTMVDPGPDLPVRLLENPPDFVWIAL
HGDKGENGKLQGLLDWLGLPYNGSGVTASAIAMDKVVSKRLFVAEGIPTPAYRVAEAVPQ
VSECQAWLAALGSPVVVKPADGGSTVGVTIAREAGHLPEAVRLALQYSPQVLIEQYIPGQ
EITVALLDGLVLPAIEIVPQGRDFYDYEAKYAPGGSRHLIPPNLAADVLKASVDAAYRAC
RAVGSTGLVRADVRVDPEGRPWVLEVNTLPGMTATSLAPEAAQAAGIDFEQLIQRIIDRS
LD
Download sequence
Identical sequences Q7NNW1
251221.gll0297 NP_923243.1.44878 gi|37519866|ref|NP_923243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]